PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s1008861g005
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family GRF
Protein Properties Length: 363aa    MW: 38622.4 Da    PI: 9.1791
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s1008861g005genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.72.4e-24248292145
                 WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                         d+epgrCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e 
  PDK_30s1008861g005 248 DPEPGRCRRTDGKKWRCSRDAVADQKYCERHMNRGRHRSRKHVEG 292
                         79****************************************985 PP

2QLQ52.51.5e-18178214137
                 QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                         ++FT++Q+++L++Q+l+yK + an+P+Pp Ll  i++
  PDK_30s1008861g005 178 GPFTPSQWMELEHQALIYKFIDANVPIPPSLLISIRR 214
                         59******************************99985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009516.7E-11178214IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.425179214IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.8E-14179212IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.455248292IPR014977WRC domain
PfamPF088791.1E-20249291IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MEGLVGGASS EGGSLFSSSL AFSDSEIKQA GVFGSSFLKH ARPGGSEEND WRFPKMARTE  60
AMAVPTNITR GAASLYRSNS HSLFPEGEQM LSFSSTPSSK PDAMVLSSDG TLPYYHHPSA  120
SSSAPYFRNA GMITLPLCSS GAMLDLWVFG GCVYGAGLGV GVSGSNANMN GVLARLRGPF  180
TPSQWMELEH QALIYKFIDA NVPIPPSLLI SIRRSLSPSG YPPISAGSFG SSALGWGPFH  240
LGYSGNADPE PGRCRRTDGK KWRCSRDAVA DQKYCERHMN RGRHRSRKHV EGHAGHAAKA  300
MPIIAPSQSA SAVSGSGSSS SLTVAQQQTK SLQPNAADPC PAPLNRYNQI NAYHFVFLTS  360
CIV
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0637595e-33BT063759.1 Zea mays full-length cDNA clone ZM_BFc0104G18 mRNA, complete cds.
GenBankBT0645385e-33BT064538.1 Zea mays full-length cDNA clone ZM_BFc0179B15 mRNA, complete cds.
GenBankBT0670855e-33BT067085.1 Zea mays full-length cDNA clone ZM_BFb0185D09 mRNA, complete cds.
GenBankBT0880165e-33BT088016.1 Zea mays full-length cDNA clone ZM_BFb0357C16 mRNA, complete cds.
GenBankEU9699095e-33EU969909.1 Zea mays clone 337118 growth-regulating factor 1 mRNA, complete cds.
GenBankEU9736475e-33EU973647.1 Zea mays clone 403513 growth-regulating factor 1 mRNA, complete cds.
GenBankKJ7268775e-33KJ726877.1 Zea mays clone pUT3418 GRF transcription factor (GRF1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008790288.10.0PREDICTED: growth-regulating factor 6-like
TrEMBLM0SET01e-125M0SET0_MUSAM; Uncharacterized protein
TrEMBLM0TTV61e-121M0TTV6_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr3P15140_0011e-124(Musa acuminata)
STRINGGSMUA_Achr8P26530_0011e-120(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42903568
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.14e-45growth-regulating factor 1